PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054488.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 330aa    MW: 36030.9 Da    PI: 6.0906
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054488.50genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.51.3e-3249103155
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   k+rlrW++eLHe+Fv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  EcC054488.50  49 KQRLRWNNELHEHFVDAVAQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 103
                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.5846106IPR017930Myb domain
SuperFamilySSF466898.96E-1748103IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-3148104IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-2449104IPR006447Myb domain, plants
PfamPF002491.1E-751102IPR001005SANT/Myb domain
PfamPF143791.8E-23135181IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010071Biological Processroot meristem specification
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0019464Biological Processglycine decarboxylation via glycine cleavage system
GO:0031087Biological Processdeadenylation-independent decapping of nuclear-transcribed mRNA
GO:0055114Biological Processoxidation-reduction process
GO:0071365Biological Processcellular response to auxin stimulus
GO:0000932Cellular Componentcytoplasmic mRNA processing body
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0005960Cellular Componentglycine cleavage complex
GO:0003677Molecular FunctionDNA binding
GO:0003723Molecular FunctionRNA binding
GO:0005506Molecular Functioniron ion binding
GO:0016705Molecular Functionoxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037Molecular Functionheme binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MYQQRSAPSS SLVRNNSFTE GQQLDCGADA MVPMNGGNSL SNNSNLASKQ RLRWNNELHE  60
HFVDAVAQLG GPDRATPKGV LRVMGVPGLT IYHVKSHLQK YRLAKYLPDS SSDGKNAEKK  120
DSADIASNTD GSSGMQITEA LKLQMEVQKR LHEQLEVQRQ LQLRIEAQGK YLKKIIEEQQ  180
RLSGVLTDGS GLGDDCLESD KKSDPATPAP TSECPLQEKA SEDHAPGKSH SIDESLSSHH  240
EPQTPDSGCH VRPIAESPEG EKQAKKQRLT EDAAYAAEEL FTPHPILDSG LNSSYQQSHP  300
AFLTREQFDP SLGISIANGE QPRKVSSGSL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010059710.10.0PREDICTED: uncharacterized protein LOC104447696
TrEMBLA0A059CC280.0A0A059CC28_EUCGR; Uncharacterized protein
STRINGVIT_00s0475g00040.t011e-169(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-106G2-like family protein